|
|
Peptide Synthesis Price List Cat.NO.SG00102
EUR €/ Residue for 6-30 mer peptides (EUR €)
 |
Crude |
Desalted |
>75% |
>85% |
>90% |
>95% |
>98% |
| 1-4mg |
€2.41 |
€4.22 |
€7.13 |
€9.38 |
€13.11 |
€14.64 |
€21.00 |
| 5-9mg |
€2.86 |
€4.76 |
€7.62 |
€10.48 |
€14.29 |
€16.19 |
€23.81 |
| 10-20mg |
€3.57 |
€5.71 |
€8.57 |
€11.43 |
€15.24 |
€17.14 |
€24.76 |
| 21-30mg |
€4.28 |
€6.67 |
€10.00 |
€13.33 |
€16.67 |
€20.00 |
€30.48 |
| 31-40mg |
€5.00 |
€7.62 |
€11.43 |
€15.24 |
€19.05 |
€24.76 |
€36.19 |
| 41-50mg |
€5.72 |
€8.57 |
€12.86 |
€17.14 |
€21.43 |
€25.71 |
€38.10 |
| 51-60mg |
€6.43 |
€9.52 |
€14.29 |
€19.05 |
€23.81 |
€28.57 |
€52.38 |
| 61-70mg |
€7.14 |
€10.48 |
€15.71 |
€20.95 |
€26.19 |
€31.43 |
€57.14 |
| 71-80mg |
€7.86 |
€11.43 |
€17.14 |
€22.86 |
€28.57 |
€34.29 |
€62.86 |
| 81-90mg |
€8.57 |
€12.38 |
€18.57 |
€24.76 |
€30.95 |
€37.14 |
€68.57 |
| 91-100mg |
€9.29 |
€13.33 |
€20.00 |
€26.67 |
€36.19 |
€40.00 |
€76.19 |
| 500mg |
€11.43 |
€19.05 |
€28.57 |
€38.10 |
€57.14 |
€80.95 |
€142.86 |
| 1000mg |
€14.29 |
€28.57 |
€42.86 |
€57.14 |
€80.95 |
€104.76 |
€209.52 |
| 2000mg |
€21.43 |
€38.10 |
€57.14 |
€76.19 |
€95.24 |
€142.86 |
€285.71 |
| 3000mg |
€28.58 |
€47.62 |
€71.43 |
€95.24 |
€119.05 |
€180.95 |
€619.05 |
 Peptide Synthesis Order Form
Peptide Synthesis Note:
1.Unit Price is EUR€ per Amino Acid.
2.Price is valid for peptides of Six (6) to Thirty (30) in length.
3.No set up charge and purification is included.
4.Discount will be offered for large quantity and large-scale synthesis.E-mail:syn@synthesisgene.com
5.If a peptide is shorter than six residues or longer than 30 residues, please inquire.
6.Shipping is an extra.Freight is €28.00.Free to design peptide or antigen.
7.For modified synthetic peptides such as Acetylation, Fluorescence dye labeling, Disulfide bridge formation,BSA Conjugation,Map Conjugation,KLH Conjugation, please inquire.
8.We offer HPLC chromatogram,Mass spec analysis,Synthesis report for every peptide.
9.First order discount,trial order discount,large order discount.please contact us for a quote.E-mail: syn@synthesisgene.com or shinegene@vip.163.com
ADM2 Peptide:
1.Human
IMD1-53:HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2(N-C)
Human IMD1-47:TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2(N-C)
Human IMD8-47:VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2(N-C)
2.Mouse
IMD1-53:PTGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY-NH2(N-C)
Mouse IMD1-47:PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY-NH2(N-C)
Mouse IMD8-47:VGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY-NH2(N-C)
3.Rat
IMD1-53:HVGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2(N-C)
Rat IMD1-47:PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2(N-C)
Rat IMD8-47:VGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2(N-C)
How to
dissolve a peptide?
Peptide solubility is sequence dependent. If
experimentally tolerated, the peptide sequence should
contain at least 20% charged residues to facilitate
solubilization. Meanwhile, A peptide is a kind of bioactive
molecules. Improper solubilization can result in loss of the
peptide, or even the failure of your experiment.
Most peptides are easy to dissolve in aqueous solutions.
However, a common problem encountered is very low solubility
or even insolubility of peptides, especially peptides with
chains of hydrophobic amino acids. During research, there
are at least three fundamental requirements in selecting a
solvent to dissolve the peptide prior to use. 1) Selecting
the solvent that effectively dissolves the peptide. 2) The
solvent has to be compatible with the experimental
application. 3) The solvent should not react with or promote
degradation of the peptide. When the availability of the
sample is not an issue, it is always a good idea to test the
solubility of a small portion of the sample before
dissolving the entire sample. It is also advisable to choose
an initial solvent that can be easily removed by
lyophilization in the event that you need to recover the
peptide.
The following suggestions may be helpful in solubilizing
your peptide
| Num |
Peptide |
Suggestions |
| 1 |
Soluble buffer |
PH7(*) |
| 2 |
Soluble temperature |
>40℃,home temperature
usually |
| 3 |
Oligopeptide (peptide
residues<5） |
Soluble in aqueous buffer |
| 4 |
Hydrophilic peptides
charged residues >25%(e.g.Asp, Arg, Lys, His, Glu) |
soluble in water or
aqueous buffer |
| 5 |
high(>75%)proportion of
Arg,Lys,His,Ser,Tyr,Thr,Asp,Asn,Glu,Gln |
Nearly not dissolvable in
aqueous buffer. |
| 6 |
Hydrophobic peptides
containing ≥50% |
Nearly not dissolvable in
aqueous buffer. |
Note:
If peptides include cysteine, met or trephine. An oxygen
free solution should be used.
For Hydrophobic peptides, 50% (v/v) DMSO / water mixture and
subsequently add water / buffer until the desired
concentration is achieved.
Related Link
siRNA Construction
Gene Synthesis
Chromas
Make Antibody
Lab Consumables
|
|
